General description

Myeloid/lymphoid or mixed-lineage leukemia 4 (MLL4) is a histone-lysine N-methyltransferase widely expressed in the nucleus of multiple cell types. It contains a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET domain.

Immunogen

Synthetic peptide directed towards the N terminal region of human MLL4

Biochem/physiol Actions

MLL4 a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. MLL4 is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer

Sequence

Synthetic peptide located within the following region: WAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.