Immunogen
Synthetic peptide directed towards the N terminal region of human MLSTD2
Application
Anti-MLSTD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
MLSTD2 is popularly known as fatty acyl CoA reductase 1 (FAR1) is a transmembrane protein involved in the rate-limiting step of plasmalogen synthesis. It supplies fatty alcohols and catalyzes the ether bond formation in the synthesis of ether glycerophospholipid.
Sequence
Synthetic peptide located within the following region: LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51313111
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV50044-100UL