Immunogen
Synthetic peptide directed towards the N terminal region of human MMP23B
Application
Anti-MMP23B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
MMP23B (matrix metallopeptidase 23B) gene encodes a single-pass type II membrane protein that belongs to matrix metalloproteinase (MMP) family and is expressed primarily in ovary, testis and prostate. Matrix metalloproteinase (MMP) family proteins facilitate the breakdown of extracellular matrix (ECM) components as well as processes cytokines and growth factors. Human MMP23B stimulates TNF shedding in a cell culture system. In zebrafish, Mmp23b plays a crucial role in augmenting liver development and hepatocyte proliferation via tumor necrosis factor pathway.
Sequence
Synthetic peptide located within the following region: ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51111745
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV46808-100UL