Immunogen

Synthetic peptide directed towards the C terminal region of human MOGAT1

Application

Anti-MOGAT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Monoacylglycerol O-acyltransferase 1 (MOGAT1) catalyzes the synthesis of diacylglycerols that in turn act as precursors for the triacylglycerols and phospholipids. MOGAT enzymes are highly expressed in the liver; hepatic MOGAT1 is a potential therapeutic target for metabolic disorders such as obesity, steatosis and type 2 diabetes mellitus.

Sequence

Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.