Immunogen
Synthetic peptide directed towards the C terminal region of human MPG
Application
Anti-MPG antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
N-methylpurine-DNA glycosylase (MPG) is an enzyme that repairs the genome-wide damage caused by alkylating agents. MPG repairs the hypoxanthine that is formed by the deamination of adenine and 1,N6-ethenoadenine formed as a result of interaction of lipid peroxidation-derived aldehydes and hydroxyalkenals with DNA. A functional linkage between MPG and p53; MPG acting as the selective regulator of p53-mediated cell cycle arrest.
Sequence
Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV44694-100UL