General description
Metal-response element-binding transcription factor 1 (MTF1) is a cellular zinc sensor that is involved in zinc homeostasis. MTF1 is also known to protect against oxidative stress and metal toxicity. Furthermore, MTF1 can modulate metallothionein gene expression.
Rabbit Anti-MTF1 antibody recognizes human, mouse, rat, bovine, and canine MTF1.
Immunogen
Synthetic peptide directed towards the C terminal region of human MTF1
Application
Rabbit Anti-MTF1 antibody can be used for western blot applications at a concentration of 5.0μg/ml.
Biochem/physiol Actions
The zinc finger transcription factor MTF-1 (metal-responsive transcription factor-1) is conserved from insects to vertebrates. The major role of MTF-1 in both organisms is to control the transcription of genes involved in the homeostasis and detoxification of heavy metal ions such as Cu2+, Zn2+ and Cd2+. In mammals, MTF-1 serves at least two additional roles. First, targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration, revealing a stage-specific developmental role. Second, under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene placental growth factor (PIGF), an angiogenic protein.
Sequence
Synthetic peptide located within the following region: QSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV32027-100UL
