General description
MyF5 (MyoD) regulates the determination of skeletal myoblasts during embryonic development. Inactivation of MyF5 in mice results in abnormal development of the ribs, which eventually leads to perinatal death.
Rabbit Anti-MyF5 antibody recognizes chicken, pig, human, mouse, rat, and bovine MyF5.
Immunogen
Synthetic peptide directed towards the N terminal region of human MYF5
Application
Rabbit Anti-MyF5 antibody can be used for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
MYF5 is a member of the myogenic basic helix-loop-helix family of transcription factors, which can activate the muscle differentiation program.
Sequence
Synthetic peptide located within the following region: ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV32134-100UL