General description
MyF6 is a possible helix-loop-helix protein that may be involved in muscle differentiation. It is known to have conserved DNA binding and dimerization domains.
Rabbit Anti-MyF6 antibody recognizes canine, human, mouse, rat, bovine, zebrafish, pig, and chicken MyF6.
Immunogen
Synthetic peptide directed towards the N terminal region of human MYF6
Application
Rabbit Anti-MyF6 antibody can be used for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.
Sequence
Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51473101
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV32135-100UL
