Immunogen
Synthetic peptide directed towards the N terminal region of human NEK7
Application
Anti-NEK7antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
NIMA-related kinase 7 (NEK7), a serine/threonine protein kinase is required for the proper formation of spindle during mitosis. NEK7 recruits centrosomal pericentriolar material (PCM) proteins which are required for centriole duplication and spindle pole formation. Optimum activity of NEK7 is necessary for cell cycle progression during M and G1 phase and during cytokinesis.
Sequence
Synthetic peptide located within the following region: KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48999-100UL