Immunogen
Synthetic peptide directed towards the middle region of human NPTN
Application
Anti-NPTN antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.
Biochem/physiol Actions
NPTN (neuroplastin) gene encodes a single-pass type I membrane protein that belongs to immunoglobulin superfamily and is expressed in brain cortex and cerebellum. It plays a crucial role in the development and maintenance of normal synaptic connections in the cerebellum.
Sequence
Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV46899-100UL