Immunogen
Synthetic peptide directed towards the N terminal region of human NR2F2
Application
Anti-NR2F2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions
NR2F2 is an orphan nuclear receptor that plays an important role in metabolism and development. The crosstalk between NR2F2 and the transcription factor HNF4α is involved in regulation of insulin secretion and maintenance of glucose homeostasis. NR2F2 collaborates with OCT4 and miR-302 in differentiation of human embryonic stem cells and specification of neural ectoderm during development.
Sequence
Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV100816-100UL