General description
Nuclear respiratory factor 1 (NRF1) is a transcription factor that activates cassettes of metabolic genes that regulate cellular respiratory and oxidative stress genes involved in heme biosynthesis, mitochondrial DNA transcription and replication and antioxidant enzymes. NRF1 and NRF2 function to mediate biogenomic coordination between nuclear and mitochondrial genomes.
The previously assigned protein identifier Q96AN2 has been merged into Q16656. Full details can be found on the UniProt database.
Specificity
Anti-NRF1 polyclonal antibody reacts with human nuclear respiratory factor 1.
Immunogen
Synthetic peptide directed towards the C terminal region of human NRF1
Application
Anti-NRF1 polyclonal antibody is used to tag nuclear respiratory factor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of nuclear respiratory factor 1 in respiratory and antioxidation processes and nuclear, mitochondrial biogenomic coordination.
Biochem/physiol Actions
NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth.This gene encodes a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized.
Sequence
Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV38543-100UL