General description
NRIP3 codes for nuclear receptor interacting protein 3. It may be involved in pediatric acute myeloid leukemia.
Rabbit Anti-NRIP3 antibody recognizes canine, bovine, human, mouse, and rat NRIP3.
Immunogen
Synthetic peptide directed towards the middle region of human NRIP3
Application
Rabbit Anti-NRIP3 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
The exact functions of NRIP3 remain unknown.
Sequence
Synthetic peptide located within the following region: ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEH
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51132306
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV50642-100UL
