ANTI-NUDT15 (C15-1744-113)

Immunogen

The immunogen for anti-NUDT15 antibody: synthetic peptide derected towards the N terminal of human NUDT15

Biochem/physiol Actions

Nudt15 mediates the hydrolysis of some nucleoside diphosphate derivatives. It can degrade 8-oxo-dGTP in vitro, suggesting that it may remove an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool, thereby preventing misincorporation of 8-oxo-dGTP into DNA thus preventing A:T to C:G transversions. Its substrate specificity in vivo however remains unclear. Nudt15 may have a role in DNA synthesis and cell cycle progression throught the interaction with PCNA.

Sequence

Synthetic peptide located within the following region: RKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.