Immunogen
Synthetic peptide directed towards the N terminal region of human NUFIP2
Application
Anti-NUFIP2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
Nuclear fragile X mental retardation protein interacting protein 2 (NUFIP2) is an RNA-binding protein involved in posttranslational regulation. It is found in association with actively translating polyribosomes, RNA granules in cytoplasm, RNA complexes in neurites and RNAi machinery.
Sequence
Synthetic peptide located within the following region: IPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51202400
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV51676-100UL