Immunogen
Synthetic peptide directed towards the C terminal region of human PAOX
Application
Anti-PAOX (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
PAOX [polyamine oxidase (exo-N4-amino)] encodes a FAD containing enzyme that catalyzes the oxidation of N(1)-acetylspermine and N1-acetylspermidine to spermidine and putrescine, respectively. It is, therefore, involved in the polyamine back-conversion. It also facilitates the regulation of polyamine intracellular concentration.
Sequence
Synthetic peptide located within the following region: LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51261602
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV53829-100UL