Immunogen
Synthetic peptide directed towards the N terminal region of human PAXIP1
Application
Anti-PAXIP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
PAX interacting (with transcription-activation domain) protein 1 (PAXIP1) is a nuclear protein that belongs to the paired box gene family. It is characterized by six breast cancer carboxy-terminal (BRCT) domains. PAXIP1 is involved in chromatin condensation during mitosis and maintenance of genome stability.
Sequence
Synthetic peptide located within the following region: MFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV51642-100UL