General description
PBX3 is a homeobox transcription factor that shares homology with the human proto-oncogene, PBX1. It is known to enhance the transcriptional functions of HOX proteins and can also modulate developmental genes. Furthermore, PBX1 can regulate cell proliferation and has been implicated in gastric cancer.
Rabbit Anti-PBX3 antibody recognizes human, mouse, rat, bovine, chicken, and zebrafish PBX3.
Immunogen
Synthetic peptide directed towards the N terminal region of human PBX3
Application
Rabbit Anti-PBX3 antibody can be used for western blot applications at a concentration of 2.5μg/ml.
Biochem/physiol Actions
PBX3 is a transcriptional activator that binds the sequence 5′-ATCAATCAA-3′.
Sequence
Synthetic peptide located within the following region: SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIM
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201571
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV32070-100UL
