General description
Mouse polyclonal antibody raised against a full-length human PDP2 protein.
PDP2 (Pyruvate dehyrogenase phosphatase catalytic subunit 2) is a mitochondrial serine phosÂÂphatase consisting of a catalytic subunit (PDP2c). It is a Mg2+ dependent enzyme. It has two active isoforms PDP 1 and 2. It is expressed in mammalian mitochondria.
Immunogen
PDP2 (NP_065837.1, 1 a.a. ~ 529 a.a) full-length human protein.
Sequence
MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
Application
Anti-PDP2 antibody produced in mouse is suitable for western blot analysis.
Biochem/physiol Actions
PDP2 (Pyruvate dehyrogenase phosphatase catalytic subunit 2) is indirectly associated with glycolysis and the tricarboxylic acid cycle and fatty acid (FA) synthesis. It is an Mg2+ dependent enzyme. PDP2 is mainly involved in the activation of phosphorylated pyruvate dehydrogenase complex (PDC), which is an essential component for the stimulation of the oxidative decarboxylation of pyruvate.
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51391813
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1407792-50UG
- Temperature Control Device:
- Yes