General description
PDPK1 is a kinase that regulates several signaling pathways mediated by various hormones and growth factors. PDPK1 has been implicated in breast cancer metastasis and prostate cancer progression.
Rabbit Anti-PDPK1 antibody recognizes human, mouse, rat, zebrafish, and pig PDPK1.
Immunogen
Synthetic peptide directed towards the middle region of human PDPK1
Application
Rabbit Anti-PDPK1 antibody has been used for western blot assays at a concentration of 0.5μg/ml.
Biochem/physiol Actions
PDPK1 phosphorylates and activates not only PKB/AKT, but also PKA, PKC-zeta, RPS6KA1 and RPS6KB1. It may play a general role in signaling processes and in development.
Sequence
Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV30313-100UL