General description
Phosphoglycerate mutase 2 (muscle) (PGAM2) catalyzes the the conversion of 3-phosphoglycrate to 2-phosphoglycerate during glucolysis. Genetic alterations in PGAM2 have been linked to muscle phosphoglycerate mutase deficiency and Greig cephalopolysyndactyly syndrome.
Rabbit Anti-PGAM2 antibody recognizes human, mouse, rat, zebrafish, and pig PGAM2.
Immunogen
Synthetic peptide directed towards the N terminal region of human PGAM2
Application
Rabbit Anti-PGAM2 antibody is suitable for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
Sequence
Synthetic peptide located within the following region: MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKM
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116127
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48138-100UL