Immunogen

Synthetic peptide directed towards the middle region of human PHF6

Application

Anti-PHF6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Biochem/physiol Actions

PHD finger protein 6 (PHF6) localizes to the nucleolus and has a role in transcriptional regulation. It regulates cell cycle progression by suppressing the synthesis of ribosomal RNA. Mutations in PHF6 gene have been implicated in Borjeson-Forssman-Lehmann syndrome and chronic myeloid leukemia.

Sequence

Synthetic peptide located within the following region: LEPSSPKSKKKSRKGRPRKTNFKGLSEDTRSTSSHGTDEMESSSYRDRSP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.