General description
The previously assigned protein identifier B1AML3 has been merged into Q8TEQ8. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the N terminal region of human PIGO
Application
Anti-PIGO antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Phosphatidylinositol glycan anchor biosynthesis, class O (PIGO; HPMRS2) protein is involved in the biosynthesis of glycosylphosphatidylinositol anchor that is present on blood cells and anchors the cell surface proteins. Mutations in PIGO gene results in hyperphosphatasia with mental retardation (HPMRS).
Sequence
Synthetic peptide located within the following region: LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV50093-100UL