General description
PIGV codes for a mannosyltransferase enzyme that regulates glycosylphosphatidylinositol (GPI) synthesis. Mutations in this gene have been linked to hyperphosphatasia mental retardation (HPMR) syndrome.
Rabbit Anti-PIGV antibody recognizes human, mouse, rat, canine, and bovine PIGV.
Immunogen
Synthetic peptide directed towards the N terminal region of human PIGV
Application
Rabbit Anti-PIGV antibody is suitable for western blot applications at a concentration of 1 μg/ml and for IHC using paraffin-embedded tissues at 4-8 μg/ml.
Biochem/physiol Actions
Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core.
Sequence
Synthetic peptide located within the following region: FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51183618
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV47358-100UL