Immunogen
Synthetic peptide directed towards the middle region of human PIGW
Application
Anti-PIGW antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
Phosphatidylinositol glycan anchor biosynthesis, class W (PIGW; Gwt1) mediates the acetylation of inositol ring of phosphatidylinositol during the biosynthesis of glycosylphosphatidylinositol (GPI). GPI acts as an anchor to cell surface proteins. Mutations in PIGW result in deficiency of GPI observed in West syndrome and hyperphosphatasia with mental retardation syndrome.
Sequence
Synthetic peptide located within the following region: IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV49147-100UL