Immunogen

Synthetic peptide directed towards the N terminal region of human PILRA

Application

Anti-PILRA antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Biochem/physiol Actions

PILRA (Paired immunoglobin-like type 2 receptor alpha) gene encodes a single-pass type I membrane protein predominantily expressed in immune cells like monocytes, granulocytes and dendritic cells. PILR-associating neural protein (PANP) is a ligand for PILRA that facilitates the immune system regulation. It plays a pivotal role in regulating cell signaling via SHP-1 by balancing the PILRalpha-mediated inhibition and PILRbeta-mediated activation. Additionally, PILRalpha facilitates as a coreceptor that acquaints with glycoprotein B (gB) and assists in herpes simplex virus-1 entry. Further, it regulates the membrane fusion of the viral envelope with cellular membranes during virus entry and virus-induced cell-to-cell fusion.

Sequence

Synthetic peptide located within the following region: IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.