General description
Phospholipase A2 receptor 1 (PLA2R1) is a type I transmembrane glycoprotein, which is a member of mannose receptor family. It consists of NH2-terminal cysteine-rich domain, a fibronectin-like type II (FNII) domain, a tandem repeat of 8 C-type lectin-like domains (CTLD) and a short intracellular COOH-terminal region. PLA2R1 is localized in the podocytes of kidney. The gene is located on human chromosome 2q24.
Immunogen
Phospholipase a2 receptor 1, 180kda recombinant protein epitope signature tag (PrEST)
Sequence
EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Application
Anti-PLA2R1 antibody produced in rabbit has been used in immunohistochemistry and indirect immunofluorescence.
Biochem/physiol Actions
Phospholipase A2 receptor 1 (PLA2R1) is implicated in primary membranous nephropathy (PMN).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST72110.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- HPA012657-100UL