ANTI-PNCK (C15-1748-835)

Sigma Aldrich

Catalog No.: C15-1748-835
Manufacturer No.: SAB1408333-50UG
Manufacturer Name: Sigma-Aldrich
Quantity: 1
Unit of Measure: EA

Price: $708.11

List Price: $1,089.40

General description PNCK is a member of the calcium/calmodulin-dependent protein kinase family of protein serine/threonine kinases (see CAMK1: MIM 604998) (Gardner et al., 2000 [PubMed 10673339]).

Enjoy exclusive benefits including discounted pricing on orders by contacting our Sales Executives to open an account. Contact Us

Current Stock:

Quantity:

Adding to cart… The item has been added

Description
Specifications

General description

PNCK is a member of the calcium/calmodulin-dependent protein kinase family of protein serine/threonine kinases (see CAMK1; MIM 604998) (Gardner et al., 2000 [PubMed 10673339]).[supplied by OMIM

Immunogen

PNCK (AAH33746.1, 1 a.a. ~ 121 a.a) full-length human protein.

Sequence
MLLLKKHTEDISSVYEIRERLGSGPSPLHSLSLLPLLSSHFLPTSHRPVCGRGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMEL

Physical form

Solution in phosphate buffered saline, pH 7.4

UPC:: 12352203
Condition:: New
Availability:: 3-5 Days
Weight:: 1.00 Ounces
HazmatClass:: No
WeightUOM:: LB
MPN:: SAB1408333-50UG
Product Size:: 50/µG

Cenmed Satisfaction Guarantee

At Cenmed, your confidence and satisfaction are paramount. We guarantee the quality and reliability of our extensive range of clinical and laboratory supplies. If you're not completely satisfied with your purchase, we offer a straightforward return process and dedicated support to resolve your concerns promptly. Our commitment ensures that you can order with confidence, knowing that Cenmed is dedicated to superior service and customer satisfaction. Trust us to meet your needs with every order, backed by our promise of excellence. Learn more in Help & FAQs.

"Cenmed provides me access to the same products/services normally reserved for much larger labs than mine. I was presently surprised by their product offering."