Immunogen

The immunogen for anti-PNCK antibody: synthetic peptide derected towards the C terminal of human PNCK

Biochem/physiol Actions

Pnck is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro, Pnck phosphorylates CREB1 and SYN1/synapsin I and phosphorylates and activates CAMK1.

Sequence

Synthetic peptide located within the following region: KAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.