General description
POLK codes for polymerase (DNA directed) κ that facilitates DNA-damage bypass via the extension step of lesion bypass. POLK promoter is negatively regulated by p53.
Rabbit Anti-POLK antibody recognizes human, mouse, rat, canine, and bovine POLK.
Immunogen
Synthetic peptide directed towards the middle region of human POLK
Application
Rabbit Anti-POLK antibody is suitable for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. It lacks 3′-5′ proofreading exonuclease activity. POLK forms a Schiff base with 5′-deoxyribose phosphate at abasic sites, but does not have lyase activity.
Sequence
Synthetic peptide located within the following region: ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48793-100UL