Immunogen
Synthetic peptide directed towards the C terminal region of human POP4
Biochem/physiol Actions
POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5′-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.
Sequence
Synthetic peptide located within the following region: EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181865
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV40674-100UL
