General description
The gene Popeye domain containing 3 (POPDC3; POP3) is mapped to human chromosome 6q21. POPDC3 is a transmembrane protein expressed in cardiac and skeletal muscles. It belongs to POPDC gene family.
Immunogen
Synthetic peptide directed towards the C terminal region of human POPDC3
Application
Anti-POPDC3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
The expression of Popeye domain containing 3 (POPDC3; POP3) is essential for the development of cardiac and skeletal tissues during the development of vertebrates. POPDC3 is identified as a cAMP binding protein. Decrease in the expression of POPDC3 due to promoter hypermethylation correlates with poor prognosis of gastric cancer.
Sequence
Synthetic peptide located within the following region: YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51282110
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV49710-100UL
