ANTI-PPAT (C15-1341-577)

General description

Phosphoribosyl pyrophosphate amidotransferase/glutamine phosphoribosyl pyrophosphate amidotransferase (PPAT, PRAT, ATASE, GPAT) catalyzes the first committed step in de novo purine biosynthesis by converting α-phosphoribosylpyrophosphate (α-PRPP) into 5-β-phosphoribosylamine. Phosphoribosylamine (PRA) is the first intermediate in the common purine/thiamine biosynthetic pathway.

Specificity

Anti-PPAT polyclonal antibody reacts with bovine, rat, canine, and human phosphoribosyl pyrophosphate amidotransferase/glutamine phosphoribosyl pyrophosphate amidotransferase enzymes.

Immunogen

Synthetic peptide directed towards the N terminal region of human PPAT

Application

Anti-PPAT polyclonal antibody is used to tag phosphoribosyl pyrophosphate amidotransferase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of phosphoribosyl pyrophosphate amidotransferase in purine/pyrimidine biosynthesis.

Biochem/physiol Actions

PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Sequence

Synthetic peptide located within the following region: VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.