Immunogen
Synthetic peptide directed towards the N terminal region of human PPCDC
Application
Anti-PPCDC antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
PPCDC (phosphopantothenoylcysteine decarboxylase) gene also referred to as FLJ14585 or MDS018 encodes for an enzyme that belongs to larger family of cysteine decarboxylases including the lantibiotic-biosynthesizing enzymes EpiD and MrsD. It catalyzes the biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5). PPCDC is required as one of the last enzymes in CoA synthesis, where it causes decarboxylation of the cysteine moiety of 4′-phosphopantothenoylcysteine (PPC) to form 4′-phosphopantetheine (PPantSH).
Sequence
Synthetic peptide located within the following region: VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352200
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV46307-100UL