General description
Prdm13 is a histone methyltransferase that belongs to the Ptf1a synexpression group. It forms an important part of the Ptf1a pathway that regulates the balance between GABAergic and glutamatergic neuronal fates in vertebrate neural tubes.
Rabbit Anti-PRDM13 antibody recognizes human, mouse, rat, and canine PRDM13.
Immunogen
Synthetic peptide directed towards the C terminal region of human PRDM13
Application
Rabbit Anti-PRDM13 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.
Biochem/physiol Actions
PRDM13 may be involved in transcriptional regulation.
Sequence
Synthetic peptide located within the following region: SLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51183619
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV39506-100UL