Immunogen
Synthetic peptide directed towards the N terminal region of human PRIM1
Application
Anti-PRIM1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
Biochem/physiol Actions
Human DNA primase 1 (PRIM1) is a pivotal enzyme component of complex chromosomal replication apparatus. It functions in synchronization with DNA polymerase alpha during replication in eukaryotic cells. DNA primase facilitates the synthesis of small RNA primers that initiate synthesis of the lagging DNA strand.
Sequence
Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV46013-100UL