General description
PTDSR is a nuclear protein that has a JmjC domain. This protein has been shown to function as a lysyl-5-hydroxylase that is involved in alternative RNA splicing.
Rabbit Anti-PTDSR (AB1) antibody recognizes bovine, rat, human, chicken, zebrafish, mouse, and canine PTDSR.
Immunogen
Synthetic peptide directed towards the middle region of human PTDSR
Application
Rabbit Anti-PTDSR (AB1) antibody can be used for western blot application at a concentration of 0.25μg/ml.
Biochem/physiol Actions
PTDSR is required during embryogenesis and differentiation of multiple organs during embryogenesis. PTDSR probably acts as a key regulator of hematopoietic differentiation. PTDSR may not be required for apoptotic cell clearance by macrophages but seems to be necessary for the regulation of macrophage cytokine responses
Sequence
Synthetic peptide located within the following region: PRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV31807-100UL