General description
RAB11B is a GTP-binding protein that regulates diverse cellular functions.It is expressed in vesicular compartments in parietal and epithelial cells. Neuronal Rab11b has been implicated in exocytosis.
Rabbit Anti-RAB11B antibody recognizes zebrafish, human, mouse, rat, canine, chicken, and bovine RAB11B.
Immunogen
Synthetic peptide directed towards the C terminal region of human RAB11B
Application
Rabbit Anti-RAB11B antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.
Biochem/physiol Actions
RAB11B possesses GTPase activity.
Sequence
Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48246-100UL