Immunogen

Synthetic peptide directed towards the middle region of human RCOR1

Biochem/physiol Actions

RCOR1 is a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequence

Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.