General description
RCOR2 is a part of the LSD1 complex and is known to modulate ESC properties. RCOR2 also substitutes for SOX2 during somatic cell reprogramming.
Rabbit Anti-RCOR2 antibody recognizes canine, bovine, human, mouse, and rat RCOR2.
Immunogen
Synthetic peptide directed towards the N terminal region of human RCOR2
Application
Rabbit Anti-RCOR2 antibody is suitable for western blot applications at a concentration of 1 mg/mL.
Biochem/physiol Actions
RCOR2 may act as a component of a corepressor complex that represses transcription.
Sequence
Synthetic peptide located within the following region: YYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPAD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51202400
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV34671-100UL
