Immunogen
Synthetic peptide directed towards the N terminal region of human RTN2
Application
Anti-RTN2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.
Biochem/physiol Actions
RTN2 (reticulon 2) gene also referred to as NSP2 or NSPL1 is a member of reticulon encoding gene family. It plays a pivotal role in organizing endoplasmic reticulum and distal motor axons. RTN2B, isoform of RTN2 regulates the trafficking as well as facilitates as a positive modulator for delivering the EAAC1 (excitatory amino acid carrier 1) from ER to the cell surface. Mutation in RTN2 gene leads to axon-degenerative disorder hereditary spastic paraplegia type 12.
Sequence
Synthetic peptide located within the following region: MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV46626-100UL