General description
The previously assigned protein identifier Q7L7Q5 has been merged into Q9NQC3. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the middle region of human RTN4
Application
Anti-RTN4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL.
Biochem/physiol Actions
RTN4 (reticulon 4) gene is a member of reticulon encoding genes family. It is expressed in oligodendrocytes and predominantly associates with the endoplasmic reticulum. It is a component of CNS white matter that inhibits the axonal regeneration and induces collapse in dorsal root ganglion growth cones. Beta-secretase beta-site APP cleaving enzyme 1 (BACE1), is a membrane-bound aspartyl protease that plays a pivotal role in the generation of amyloid beta-protein (Abeta). RTN4 interacts with BACE1 and blocks its activity.
Sequence
Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51422325
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV46813-100UL