Immunogen
Synthetic peptide directed towards the N terminal region of human SEMA6D
Application
Anti-SEMA6D antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
Semaphorins are transmembrane and secreted proteins involved in immune responses, activation of immune cells and axon guidance during neuronal development. SEMA6D regulates the late phase of primary immune responses by the CD4+ T cells. The function and expression of SEMA6D is important during the development of mammalian retinal circuit.
Sequence
Synthetic peptide located within the following region: VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV49583-100UL