General description
Maspin/Serpin peptidase inhibitor, clade B (ovalbumin), member 5 (SerPINB5), serpin family, is a serine protease inhibitor originally identified as a tumor suppressor in epithelial cells. Maspin reduces the motility/invasiveness of tumor cells and functions as an angiogenesis inhibitor.
Specificity
Anti-SerPINB5 polyclonal antibody reacts with canine, chicken, rat, bovine, human, mouse, and rabbit Maspin/Serpin peptidase inhibitor, clade B (ovalbumin), member 5 proteins.
Immunogen
Synthetic peptide directed towards the middle region of human SERPINB5
Application
Anti-SerPINB5 polyclonal antibody is used to tag maspin for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of maspin in processes such as angiogenesis and tumor suppression.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Biochem/physiol Actions
As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
Sequence
Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV42055-100UL