Immunogen
Synthetic peptide directed towards the middle region of human SFRP1
Application
Anti-SFRP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.3 μg/ml.
Biochem/physiol Actions
Secreted Frizzled-related protein 1 (SFRP1) is a secreted antagonist of Wnt signaling pathway. It is secreted in excess amounts during DNA damage- or oxidative stress-induced cellular senescence. SFRP1 is a modulator of normal and malignant hematopoiesis and cell proliferation. Gene polymorphisms, aberrations and methylation of SFRP1 is a feature in bladder cancers resulting in excessive activation of Wnt pathway.
Sequence
Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181504
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV09053-100UL