General description
Seven in absentia homolog 1 (Drosophila) (SIAH1) is an E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. SIAH1 has an overlapping function with SIAH2. SIAH1 is involved in the regulation of cellular response to hypoxia and induction of apoptosis. SIAH1 triggers the ubiquitin-mediated degradation of many substrates including the cell surface receptors (DCC, FLT3), the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), and transcription regulators (MγB, POU2AF1, PML and RBBP8). SIAH1 confers constitutive instability to HIPK2 through proteasomal degradation.
Specificity
Anti-SIAH1 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, zebrafish, chicken, and canine seven in absentia homolog 1 (Drosophila) proteins.
Immunogen
Synthetic peptide directed towards the C terminal region of human SIAH1
Application
Anti-SIAH1 (AB2) polyclonal antibody is used to tag seven in absentia homolog 1 (Drosophila) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of seven in absentia homolog 1 (Drosophila) in many proteosome regulated cellular processes such as response to hypoxia and apoptosis.
Biochem/physiol Actions
SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson′s disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterizedThis gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson′s disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Sequence
Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV38212-100UL