Immunogen
Synthetic peptide directed towards the N terminal region of human SIX2
Biochem/physiol Actions
This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila ′sine oculis′ homeobox protein. SIX2 is a transcription factor which, like other members of this gene family, may be involved in limb or eye development.
Sequence
Synthetic peptide located within the following region: WSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41106508
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB2103006-100UL
