Immunogen

Synthetic peptide directed towards the N terminal of human SLC10A2

Biochem/physiol Actions

Slc10a2 plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. It plays a key role in cholesterol metabolism.

Sequence

Synthetic peptide located within the following region: GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.