General description
SLC14A1 codes for a protein that belongs to the solute carrier family. It facilitates the transport of urea in red blood cells and also forms the basis of the Kidd blood grouping system. SLC14A1 has been identified as a susceptibility locus for bladder cancer.
Rabbit Anti-SLC14A1 antibody recognizes human, canine, bovine, and mouse SLC14A1.
Immunogen
Synthetic peptide directed towards the C terminal region of human SLC14A1
Application
Rabbit Anti-SLC14A1 antibody is suitable for western blot applications at a concentration of western blot at a concentration of 0.25 μg/ml and for IHC at 4-8 μg/ml.
Biochem/physiol Actions
SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.
Sequence
Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116012
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV48116-100UL