Immunogen
Synthetic peptide directed towards the middle region of human SLC22A23
Application
Anti-SLC22A23 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
SLC22A23 (C6ORF85) is a member of transmembrane proteins that mediate the transport of organic ions across the cell membrane by acting as uniporters, symporters and antiporters. Single nucleotide polymorphisms in SLC22A23 gene are reportedly associated with ulcerative colitis.
Sequence
Synthetic peptide located within the following region: VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51171644
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV49670-100UL
